PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06569A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 272aa    MW: 29871.4 Da    PI: 5.4191
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06569AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.51.9e-151461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+WT+eEd +l++ +   G  +W+++++  g+ R++k+c++rw +yl
  Oropetium_20150105_06569A 14 RGPWTAEEDRKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                               89******************************99************97 PP

2Myb_DNA-binding49.31.1e-1570110446
                                S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                 T  E++  +d++++lG++ W++Ia++++ gRt++++k++w++
  Oropetium_20150105_06569A  70 LTDAEEQVVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNT 110
                                5899***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-21562IPR009057Homeodomain-like
PROSITE profilePS5129413.085961IPR017930Myb domain
SuperFamilySSF466891.55E-2611108IPR009057Homeodomain-like
SMARTSM007172.3E-121363IPR001005SANT/Myb domain
PfamPF002493.3E-141461IPR001005SANT/Myb domain
CDDcd001671.70E-91661No hitNo description
PROSITE profilePS5129426.80562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2463117IPR009057Homeodomain-like
SMARTSM007171.4E-1366114IPR001005SANT/Myb domain
PfamPF002492.5E-1370110IPR001005SANT/Myb domain
CDDcd001677.82E-1171110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGRQPCCDKL GVKRGPWTAE EDRKLINFIL TNGHCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL TDAEEQVVID LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT RIKKKLIKMG  120
IDPVTHEPLD PTGSPATASQ SVVTAESKSN EVTNKQRRPD DARDVSADGS CSLPESSTNT  180
SSTGGSSSSS SHDLQDPLVK WLLEEDPPTG DEPWLSFAGN NVDVDEFNSI AADPSALPWD  240
STTDWLLDYQ DFGLGDSNLV DEVMVVTNSS K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0417711e-152BT041771.1 Zea mays full-length cDNA clone ZM_BFb0051B11 mRNA, complete cds.
GenBankBT0624371e-152BT062437.1 Zea mays full-length cDNA clone ZM_BFb0298A24 mRNA, complete cds.
GenBankHQ8586971e-152HQ858697.1 Zea mays clone UT1153 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001307849.11e-144uncharacterized protein LOC100101510
RefseqXP_008650757.11e-144PREDICTED: LOC100101510 isoform X1
RefseqXP_008650758.11e-144PREDICTED: LOC100101510 isoform X1
SwissprotQ50EX62e-95ODO1_PETHY; Protein ODORANT1
TrEMBLB4FXD31e-144B4FXD3_MAIZE; Uncharacterized protein
TrEMBLQ4L2141e-144Q4L214_MAIZE; MYB transcription factor
STRINGGRMZM2G104551_P011e-143(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.13e-85myb domain protein 42